A database of hormones and their receptors

Peptide Hormone

Search Result - 1

HMRbase accession number	10030
Swiss-prot Accession number	P18918 (Sequence in FASTA format)
Description	Prolactin-2C4 precursor (Proliferin-3) (Mitogen-regulated protein 3).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation
Protein Length	224 Amino acids
Molecular weight	25338
References	1 PubMed abstract 2790033 2 PubMed abstract 15489334 3 PubMed abstract 8043949
Domain Name	Hormone_1
Hormone Name	Prolactin-2C4
Mature Hormone Sequence	FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFNEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYAALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC
Position of mature hormone in Pre-Hormone protein	195 Residues from position (30-224)
Receptor	Q08501 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10031
Swiss-prot Accession number	P35454 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	125 Amino acids
Molecular weight	12851
References	1 PubMed abstract 2176709 2 PubMed abstract 11471062
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	P97926 Detail in HMRbase
Gene ID	18429
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10032
Swiss-prot Accession number	P47932 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	185 Amino acids
Molecular weight	20571
References	1 PubMed abstract 8452637 2 PubMed abstract 8216305
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL
Position of mature hormone in Pre-Hormone protein	35 Residues from position (23-57)
Receptor	Q91ZZ5 Detail in HMRbase
Gene ID	19773
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	10233
Swiss-prot Accession number	Q6ZWY8 (Sequence in FASTA format)
Description	Thymosin beta-10.
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Cytoplasm (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5026
References	1 PubMed abstract 16141072
Domain Name	Thymosin
Hormone Name	Thymosin beta-10
Mature Hormone Sequence	ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	100043712 19240
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10323
Swiss-prot Accession number	Q08535 (Sequence in FASTA format)
Description	Secretin precursor.
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach
Protein Length	133 Amino acids
Molecular weight	14914
References	1 PubMed abstract 8179583
Domain Name	Hormone_2
Hormone Name	Secretin
Mature Hormone Sequence	HSDGMFTSELSRLQDSARLQRLLQGLV
Position of mature hormone in Pre-Hormone protein	27 Residues from position (32-58)
Receptor	Q5FWI2 Detail in HMRbase
Gene ID	20287
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10327
Swiss-prot Accession number	Q60687 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	130 Amino acids
Molecular weight	14919
References	1 PubMed abstract 8543187 2 PubMed abstract 16141072 3 PubMed abstract 15489334 4 PubMed abstract 8543187 5 PubMed abstract 16141072 6 PubMed abstract 15489334
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SCELTNITISVEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNTQKVCTFKELVYETVRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	P35378 Detail in HMRbase
Gene ID	14308
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 7

HMRbase accession number	10328
Swiss-prot Accession number	Q62361 (Sequence in FASTA format)
Description	Thyroliberin precursor [Contains: Prothyroliberin; Thyroliberin(Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor)(TRF) (TSH-releasing factor) (Protirelin)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	Specifically expressed in hypothalamus and testis
Post translational modification	N/A
Function	Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems
Protein Length	256 Amino acids
Molecular weight	29195
References	1 PubMed abstract 1323011 2 PubMed abstract 15489334
Domain Name	TRH
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (77-79)
Receptor	P21761 Detail in HMRbase Q9ERT2 Detail in HMRbase
Gene ID	22044
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 8

HMRbase accession number	10332
Swiss-prot Accession number	Q8CHK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin M3) (Insulin-like peptide INSL7)(Insulin-like peptide 7) [Contains: Relaxin-3 B chain; Relaxin-3 Achain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	High expression in the brain localized to the pons/medulla with highest levels in pars ventromedialis of the dorsal tegmental nucleus. Significant expression is also detected in the spleen, thymus, lung, testis and ovary
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	141 Amino acids
Molecular weight	14926
References	1 PubMed abstract 12686464 2 PubMed abstract 11689565
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RPAPYGVKLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (25-51)
Receptor	Q8BGE9 Detail in HMRbase Q7TQP4 Detail in HMRbase Q91ZZ5 Detail in HMRbase
Gene ID	212108
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 9

HMRbase accession number	10333
Swiss-prot Accession number	Q8CHK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin M3) (Insulin-like peptide INSL7)(Insulin-like peptide 7) [Contains: Relaxin-3 B chain; Relaxin-3 Achain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	High expression in the brain localized to the pons/medulla with highest levels in pars ventromedialis of the dorsal tegmental nucleus. Significant expression is also detected in the spleen, thymus, lung, testis and ovary
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	141 Amino acids
Molecular weight	14926
References	1 PubMed abstract 12686464 2 PubMed abstract 11689565
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSSCCEWGCSKSQISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (118-141)
Receptor	Q8BGE9 Detail in HMRbase Q7TQP4 Detail in HMRbase Q91ZZ5 Detail in HMRbase
Gene ID	212108
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 10

HMRbase accession number	10334
Swiss-prot Accession number	Q8CIT0 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	187 Amino acids
Molecular weight	20778
References	1 Seasholtz A.F., Bourbonais F.J., Harnden C.E., Camper S.A.; "Nucleotide sequence and expression of the mouse corticotropin-releasing hormone gene."; Mol. Cell. Neurosci. 2:266-273(1991).
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Position of mature hormone in Pre-Hormone protein	41 Residues from position (145-185)
Receptor	P35347 Detail in HMRbase Q60748 Detail in HMRbase
Gene ID	12918
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 11

HMRbase accession number	10336
Swiss-prot Accession number	Q8R1I2 (Sequence in FASTA format)
Description	Gastrin-releasing peptide precursor (GRP) [Contains: Neuromedin-C(GRP-10)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent memory for fear
Protein Length	146 Amino acids
Molecular weight	15659
References	1 PubMed abstract 16141072 2 PubMed abstract 15489334
Domain Name	Bombesin
Hormone Name	Gastrin-releasing peptide
Mature Hormone Sequence	APVSTGAGGGTVLAKMYPRGSHWAVGHLM
Position of mature hormone in Pre-Hormone protein	29 Residues from position (24-52)
Receptor	P21729 Detail in HMRbase
Gene ID	225642
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 12

HMRbase accession number	10337
Swiss-prot Accession number	Q8R1I2 (Sequence in FASTA format)
Description	Gastrin-releasing peptide precursor (GRP) [Contains: Neuromedin-C(GRP-10)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	146 Amino acids
Molecular weight	15659
References	1 PubMed abstract 16141072 2 PubMed abstract 15489334
Domain Name	Bombesin
Hormone Name	Neuromedin-C
Mature Hormone Sequence	GSHWAVGHLM
Position of mature hormone in Pre-Hormone protein	10 Residues from position (43-52)
Receptor	P21729 Detail in HMRbase
Gene ID	225642
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 13

HMRbase accession number	10343
Swiss-prot Accession number	Q925Q5 (Sequence in FASTA format)
Description	Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production
Protein Length	128 Amino acids
Molecular weight	14030
References	1 Ching A., Gilbert T., Sheppard P., Webster P., O'Hara P.J.; "A novel cysteine knot protein expressed in pancreatic acinar cells."; Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases. 2 PubMed abstract 15489334
Domain Name	N/A
Hormone Name	Glycoprotein hormone alpha-2
Mature Hormone Sequence	HSPETAIPGCHLHPFNVTVRSDRLGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSSSQCCTISSLRKVRVWLQCVGNQRGELEIFTARACQCDMCRFSRY
Position of mature hormone in Pre-Hormone protein	108 Residues from position (21-128)
Receptor	P47750 Detail in HMRbase
Gene ID	170458
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 14

HMRbase accession number	10346
Swiss-prot Accession number	Q99NF2 (Sequence in FASTA format)
Description	Nasal embryonic luteinizing hormone-releasing hormone factor (Nasalembryonic LHRH factor) (Juxtasynaptic attractor of caldendrin ondendritic boutons protein) (Jacob protein).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Cell membrane; peripheral membrane protein. Note=Found on the outside of the LHRH cell membrane and axons projecting from the olfactory pit and epithelium
Developmental Stage	At E14.5 embryo found with high level within the forebrain, olfactory epithelium and olfactory pit. At E12.5 embryo detected on olfactory axons including olfactory pathway on which the LHRH neurons move. From E11.5 to E17.5 embryos expressed in LHRH (luteinizing hormone-releasing hormone) neurons as they migrate from the olfactory pit into the developing forebrain.
Similarity	N/A
Tissue Specificity	Expressed in adult brain and liver. In the brain expressed in the cortex, hippocampus, olfactory bulb and thalamus
Post translational modification	N/A
Function	Influences outgrowth of olfactory axons and migration of LHRH neurons
Protein Length	532 Amino acids
Molecular weight	60293
References	1 PubMed abstract 10898796 2 Dieterich D.C., Hoffmann B., Seidenbecher C.I., Kreutz M.R.; "Characterization of the novel brain-specific protein Jacob."; Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 15018815
Domain Name	N/A
Hormone Name	Nasal embryonic luteinizing hormone-releasing hormone factor
Mature Hormone Sequence	MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGRYEGSISDEAVSGKPAIEGPQPHVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAQLVPGPSSRAFGLEQPPLPEAPGRHKKLERMYSVDGVSDDVPIRTWFPKENLFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL
Position of mature hormone in Pre-Hormone protein	532 Residues from position (1-532)
Receptor	Q01776 Detail in HMRbase
Gene ID	56876
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 15

HMRbase accession number	10686
Swiss-prot Accession number	P10601 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; C-terminal peptide].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	100 Amino acids
Molecular weight	11020
References	1 PubMed abstract 3343236
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPMYPGDYATPEQMAQYETQLRRYINTLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	19064
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10909
Swiss-prot Accession number	P01325 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	12160
References	1 PubMed abstract 3104603 2 PubMed abstract 2397023 3 PubMed abstract 16141072 4 PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-1 B chain
Mature Hormone Sequence	FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	16333
PDB ID	1L6Q
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10910
Swiss-prot Accession number	P01325 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	12160
References	1 PubMed abstract 3104603 2 PubMed abstract 2397023 3 PubMed abstract 16141072 4 PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-1 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	16333
PDB ID	1L6Q
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11041
Swiss-prot Accession number	P26350 (Sequence in FASTA format)
Description	Prothymosin alpha [Contains: Thymosin alpha].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Nucleus
Developmental Stage	N/A
Similarity	Belongs to the pro/parathymosin family.
Tissue Specificity	N/A
Post translational modification	Covalently linked to a small RNA of about 20 nucleotides.
Function	Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections
Protein Length	111 Amino acids
Molecular weight	12254
References	1 PubMed abstract 2015308 2 PubMed abstract 16141072 3 PubMed abstract 15489334 4 PubMed abstract 2226839 5 PubMed abstract 2479575
Domain Name	Prothymosin
Hormone Name	Prothymosin alpha
Mature Hormone Sequence	SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD
Position of mature hormone in Pre-Hormone protein	110 Residues from position (2-111)
Receptor	N/A
Gene ID	19231
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11042
Swiss-prot Accession number	P26350 (Sequence in FASTA format)
Description	Prothymosin alpha [Contains: Thymosin alpha].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Nucleus
Developmental Stage	N/A
Similarity	Belongs to the pro/parathymosin family.
Tissue Specificity	N/A
Post translational modification	Covalently linked to a small RNA of about 20 nucleotides.
Function	It is a potent immunopotentiating agent
Protein Length	111 Amino acids
Molecular weight	12254
References	1 PubMed abstract 2015308 2 PubMed abstract 16141072 3 PubMed abstract 15489334 4 PubMed abstract 2226839 5 PubMed abstract 2479575
Domain Name	Prothymosin
Hormone Name	Thymosin alpha
Mature Hormone Sequence	SDAAVDTSSEITTKDLKEKKEVVEEAEN
Position of mature hormone in Pre-Hormone protein	28 Residues from position (2-29)
Receptor	N/A
Gene ID	19231
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11061
Swiss-prot Accession number	P20065 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Originally found in thymus but it is widely distributed in many tissues
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	50 Amino acids
Molecular weight	5679
References	1 PubMed abstract 2351831 2 PubMed abstract 2226839 3 PubMed abstract 8838802
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	50 Residues from position (1-50)
Receptor	N/A
Gene ID	N/A
PDB ID	1T44
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	11062
Swiss-prot Accession number	P20065 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Originally found in thymus but it is widely distributed in many tissues
Post translational modification	N/A
Function	Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase
Protein Length	50 Amino acids
Molecular weight	5679
References	1 PubMed abstract 2351831 2 PubMed abstract 2226839 3 PubMed abstract 8838802
Domain Name	Thymosin
Hormone Name	Hematopoietic system regulatory peptide
Mature Hormone Sequence	SDKP
Position of mature hormone in Pre-Hormone protein	4 Residues from position (8-11)
Receptor	N/A
Gene ID	N/A
PDB ID	1T44
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	11198
Swiss-prot Accession number	P05125 (Sequence in FASTA format)
Description	Atrial natriuretic factor precursor (ANF) (Atrial natriuretic peptide)(ANP) (Prepronatriodilatin) [Contains: Auriculin-B; Auriculin-A;Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the natriuretic peptide family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	A potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis. Has a cGMP-stimulating activity
Protein Length	152 Amino acids
Molecular weight	16645
References	1 PubMed abstract 6542248
Domain Name	ANP
Hormone Name	Auriculin-B
Mature Hormone Sequence	RSSCFGGRIDRIGAQSGLGCNSFRY
Position of mature hormone in Pre-Hormone protein	25 Residues from position (126-150)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	11199
Swiss-prot Accession number	P05125 (Sequence in FASTA format)
Description	Atrial natriuretic factor precursor (ANF) (Atrial natriuretic peptide)(ANP) (Prepronatriodilatin) [Contains: Auriculin-B; Auriculin-A;Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the natriuretic peptide family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	A potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis. Has a cGMP-stimulating activity
Protein Length	152 Amino acids
Molecular weight	16645
References	1 PubMed abstract 6542248
Domain Name	ANP
Hormone Name	Auriculin-A
Mature Hormone Sequence	RSSCFGGRIDRIGAQSGLGCNSFR
Position of mature hormone in Pre-Hormone protein	24 Residues from position (126-149)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	11200
Swiss-prot Accession number	P05125 (Sequence in FASTA format)
Description	Atrial natriuretic factor precursor (ANF) (Atrial natriuretic peptide)(ANP) (Prepronatriodilatin) [Contains: Auriculin-B; Auriculin-A;Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the natriuretic peptide family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	A potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis. Has a cGMP-stimulating activity
Protein Length	152 Amino acids
Molecular weight	16645
References	1 PubMed abstract 6542248
Domain Name	ANP
Hormone Name	Atriopeptin-1
Mature Hormone Sequence	SSCFGGRIDRIGAQSGLGCNSFR
Position of mature hormone in Pre-Hormone protein	23 Residues from position (127-149)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	11201
Swiss-prot Accession number	P05125 (Sequence in FASTA format)
Description	Atrial natriuretic factor precursor (ANF) (Atrial natriuretic peptide)(ANP) (Prepronatriodilatin) [Contains: Auriculin-B; Auriculin-A;Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the natriuretic peptide family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	A potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis. Has a cGMP-stimulating activity
Protein Length	152 Amino acids
Molecular weight	16645
References	1 PubMed abstract 6542248
Domain Name	ANP
Hormone Name	Atriopeptin-2
Mature Hormone Sequence	SSCFGGRIDRIGAQSGLGCNS
Position of mature hormone in Pre-Hormone protein	21 Residues from position (127-147)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	11227
Swiss-prot Accession number	O09108 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15028
References	1 PubMed abstract 8543188 2 Brown P., Brooks J., McNeilly J.R., McNeilly A.S.; Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	P30730 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 27

HMRbase accession number	11282
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (205-209)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 28

HMRbase accession number	11283
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 29

HMRbase accession number	11284
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (124-162)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 30

HMRbase accession number	11285
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (124-136)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 31

HMRbase accession number	11286
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	71 Residues from position (165-235)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 32

HMRbase accession number	11287
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKD
Position of mature hormone in Pre-Hormone protein	38 Residues from position (165-202)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 33

HMRbase accession number	11288
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DDGPYRVEHFRWSNPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (185-202)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 34

HMRbase accession number	11289
Swiss-prot Accession number	P01193 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	235 Amino acids
Molecular weight	26707
References	1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (205-235)
Receptor	Q64326 Detail in HMRbase Q01727 Detail in HMRbase
Gene ID	18976
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 35

HMRbase accession number	11300
Swiss-prot Accession number	P01216 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13565
References	1 PubMed abstract 6272299 2 PubMed abstract 6177696 3 PubMed abstract 2466623 4 PubMed abstract 12112597 5 PubMed abstract 15489334 6 PubMed abstract 6272299 7 PubMed abstract 6177696 8 PubMed abstract 2466623 9 PubMed abstract 12112597 10 PubMed abstract 15489334
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P35378 Detail in HMRbase P30730 Detail in HMRbase Q562E4 Detail in HMRbase
Gene ID	12640
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 36

HMRbase accession number	11342
Swiss-prot Accession number	P01326 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12364
References	1 PubMed abstract 3104603 2 PubMed abstract 2397023 3 PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-2 B chain
Mature Hormone Sequence	FVKQHLCGSHLVEALYLVCGERGFFYTPMS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P15208 Detail in HMRbase
Gene ID	16334
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 37

HMRbase accession number	11343
Swiss-prot Accession number	P01326 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12364
References	1 PubMed abstract 3104603 2 PubMed abstract 2397023 3 PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-2 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P15208 Detail in HMRbase
Gene ID	16334
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 38

HMRbase accession number	11364
Swiss-prot Accession number	P04095 (Sequence in FASTA format)
Description	Prolactin-2C2 precursor (Proliferin-1) (Mitogen-regulated protein 1).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation
Protein Length	224 Amino acids
Molecular weight	25367
References	1 PubMed abstract 6087314 2 PubMed abstract 15489334 3 PubMed abstract 3478191
Domain Name	Hormone_1
Hormone Name	Prolactin-2C2
Mature Hormone Sequence	FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFTEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYSALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC
Position of mature hormone in Pre-Hormone protein	195 Residues from position (30-224)
Receptor	Q08501 Detail in HMRbase
Gene ID	18811
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	11368
Swiss-prot Accession number	P04768 (Sequence in FASTA format)
Description	Prolactin-2C3 precursor (Proliferin-2) (Mitogen-regulated protein 2).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation
Protein Length	224 Amino acids
Molecular weight	25312
References	1 PubMed abstract 3859868
Domain Name	Hormone_1
Hormone Name	Prolactin-2C3
Mature Hormone Sequence	FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFNEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYAALLKSGAMISDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC
Position of mature hormone in Pre-Hormone protein	195 Residues from position (30-224)
Receptor	Q08501 Detail in HMRbase
Gene ID	18812
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 40

HMRbase accession number	11378
Swiss-prot Accession number	P06879 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	226 Amino acids
Molecular weight	25496
References	1 PubMed abstract 2991252 2 PubMed abstract 3756168 3 PubMed abstract 16141072
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
Position of mature hormone in Pre-Hormone protein	197 Residues from position (30-226)
Receptor	Q08501 Detail in HMRbase
Gene ID	19109
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 41

HMRbase accession number	11379
Swiss-prot Accession number	P06880 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24716
References	1 PubMed abstract 2991252 2 PubMed abstract 8647448 3 PubMed abstract 16141072 4 PubMed abstract 15489334
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	P16882 Detail in HMRbase
Gene ID	14599
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 42

HMRbase accession number	11390
Swiss-prot Accession number	P09240 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12866
References	1 PubMed abstract 2011497 2 PubMed abstract 3862083
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVVPAEATDPVEQRAEEAPRRQLRAVLRPDREPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	12424
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 43

HMRbase accession number	11391
Swiss-prot Accession number	P09240 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12866
References	1 PubMed abstract 2011497 2 PubMed abstract 3862083
Domain Name	Gastrin
Hormone Name	Cholecystokinin-33
Mature Hormone Sequence	KAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (71-103)
Receptor	P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	12424
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 44

HMRbase accession number	11392
Swiss-prot Accession number	P09240 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12866
References	1 PubMed abstract 2011497 2 PubMed abstract 3862083
Domain Name	Gastrin
Hormone Name	Cholecystokinin-12
Mature Hormone Sequence	ISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (92-103)
Receptor	P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	12424
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 45

HMRbase accession number	11393
Swiss-prot Accession number	P09240 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12866
References	1 PubMed abstract 2011497 2 PubMed abstract 3862083
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (96-103)
Receptor	P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	12424
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 46

HMRbase accession number	11395
Swiss-prot Accession number	P09586 (Sequence in FASTA format)
Description	Prolactin-3B1 precursor (Chorionic somatomammotropin hormone 2)(Placental lactogen II) (PL-II).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	Placental lactogen I is expressed in mid- pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy.
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	222 Amino acids
Molecular weight	25159
References	1 PubMed abstract 3464966 2 PubMed abstract 1570305 3 PubMed abstract 3859868 4 PubMed abstract 3464966 5 PubMed abstract 1570305 6 PubMed abstract 3859868
Domain Name	Hormone_1
Hormone Name	Prolactin-3B1
Mature Hormone Sequence	LPNYRLPTESLYQRVIVVSHNAHDLASKAFMEFEMKFGRTAWTYGLMLSPCHTAAILTPENSEQVHQTTSEDLLKVSITILQAWEEPLKHMVAAVAALPHVPDTLLSRTKELEERIQGLLEGLKIIFNRVYPGAVASDYTFWSAWSDLQSSDESTKNSALRTLWRCVRRDTHKVDNYLKVLKCRDVHNNNC
Position of mature hormone in Pre-Hormone protein	191 Residues from position (32-222)
Receptor	Q08501 Detail in HMRbase
Gene ID	18776
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 47

HMRbase accession number	11401
Swiss-prot Accession number	P12656 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15373
References	1 PubMed abstract 3349902 2 PubMed abstract 2824501 3 PubMed abstract 6207569 4 PubMed abstract 2484718
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYTMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	P47750 Detail in HMRbase
Gene ID	22094
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 48

HMRbase accession number	11408
Swiss-prot Accession number	P13562 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); Prolactin release-inhibiting factor 1 (Prolactinrelease-inhibiting factor I)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	90 Amino acids
Molecular weight	10337
References	1 PubMed abstract 3024317 2 PubMed abstract 3024317
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLRPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (22-31)
Receptor	Q01776 Detail in HMRbase
Gene ID	14714
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 49

HMRbase accession number	11412
Swiss-prot Accession number	P16043 (Sequence in FASTA format)
Description	Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone
Protein Length	103 Amino acids
Molecular weight	12064
References	1 PubMed abstract 2514346 2 PubMed abstract 2481813 3 PubMed abstract 16141072 4 PubMed abstract 15489334
Domain Name	Hormone_2
Hormone Name	Somatoliberin
Mature Hormone Sequence	HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
Position of mature hormone in Pre-Hormone protein	42 Residues from position (31-72)
Receptor	P32082 Detail in HMRbase
Gene ID	14601
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 50

HMRbase accession number	11414
Swiss-prot Accession number	P18121 (Sequence in FASTA format)
Description	Prolactin-3D1 precursor (Chorionic somatomammotropin hormone 1)(Placental lactogen I) (PL-I).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	Placental lactogen I is expressed in mid- pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy.
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	224 Amino acids
Molecular weight	25524
References	1 PubMed abstract 3153461 2 PubMed abstract 8469232 3 PubMed abstract 8043949 4 PubMed abstract 3153461 5 PubMed abstract 8469232 6 PubMed abstract 8043949
Domain Name	Hormone_1
Hormone Name	Prolactin-3D1
Mature Hormone Sequence	SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC
Position of mature hormone in Pre-Hormone protein	195 Residues from position (30-224)
Receptor	Q08501 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 51

HMRbase accession number	11434
Swiss-prot Accession number	P27106 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age of the ovary
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	555 Amino acids
Molecular weight	59778
References	1 PubMed abstract 1782869 2 Dresser D.W., Jamin S., Atkins C.J., Guerrier D.; "A GNRP-like gene shares a bidirectional promoter with SAP62immediately upstream of AMH."; Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 8541848
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	N/A
Position of mature hormone in Pre-Hormone protein	N/A Residues from position
Receptor	Q8K592 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 52

HMRbase accession number	11441
Swiss-prot Accession number	P35454 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Neurophysin 1 specifically binds oxytocin
Protein Length	125 Amino acids
Molecular weight	12851
References	1 PubMed abstract 2176709 2 PubMed abstract 11471062
Domain Name	Hormone_5
Hormone Name	Neurophysin 1
Mature Hormone Sequence	AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER
Position of mature hormone in Pre-Hormone protein	94 Residues from position (32-125)
Receptor	P97926 Detail in HMRbase
Gene ID	18429
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 53

HMRbase accession number	11462
Swiss-prot Accession number	P47932 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	185 Amino acids
Molecular weight	20571
References	1 PubMed abstract 8452637 2 PubMed abstract 8216305
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	ESGGLMSQQCCHVGCSRRSIAKLYC
Position of mature hormone in Pre-Hormone protein	25 Residues from position (161-185)
Receptor	Q91ZZ5 Detail in HMRbase
Gene ID	19773
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 54

HMRbase accession number	11463
Swiss-prot Accession number	P48757 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	101 Amino acids
Molecular weight	11607
References	1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266
Domain Name	Gastrin
Hormone Name	Gastrin-71
Mature Hormone Sequence	SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	71 Residues from position (22-92)
Receptor	P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 55

HMRbase accession number	11464
Swiss-prot Accession number	P48757 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	101 Amino acids
Molecular weight	11607
References	1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	GSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 56

HMRbase accession number	11465
Swiss-prot Accession number	P48757 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	101 Amino acids
Molecular weight	11607
References	1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	ERPRMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 57

HMRbase accession number	11476
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity
Protein Length	180 Amino acids
Molecular weight	20906
References	1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glicentin
Mature Hormone Sequence	HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Position of mature hormone in Pre-Hormone protein	69 Residues from position (21-89)
Receptor	Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 58

HMRbase accession number	11477
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Oxyntomodulin significantly reduces food intake
Protein Length	180 Amino acids
Molecular weight	20906
References	1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Oxyntomodulin
Mature Hormone Sequence	KRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Position of mature hormone in Pre-Hormone protein	37 Residues from position (53-89)
Receptor	Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 59

HMRbase accession number	11478
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia
Protein Length	180 Amino acids
Molecular weight	20906
References	1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (53-81)
Receptor	Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 60

HMRbase accession number	11479
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton
Protein Length	180 Amino acids
Molecular weight	20906
References	1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1
Mature Hormone Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Position of mature hormone in Pre-Hormone protein	37 Residues from position (92-128)
Receptor	Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 61

HMRbase accession number	11480
Swiss-prot Accession number	P55095 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20906
References	1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMSTILDNLATRDFINWLIQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase
Gene ID	14526
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 62

HMRbase accession number	11482
Swiss-prot Accession number	P56942 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	Expression is enhanced between postnatal days 10 and 15.
Similarity	Belongs to the MCH family.
Tissue Specificity	Predominantly expressed in hypothalamus. Also found in heart, intestine, spleen and testis (spermatogonia, early spermatocytes and Sertoli cells). In brain only mature MCH and NEI peptides are present. In peripheral tissues a large product, encompassing the NEI and MCH domains of the precursor, is found predominantly
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6. MCH is a cyclic peptide.
Function	N/A
Protein Length	166 Amino acids
Molecular weight	18645
References	1 Breton C., Presse F., Hervieu G., Nahon J.-L.; "Structure and regulation of the mouse melanin-concentrating hormonemRNA and gene."; Mol. Cell. Neurosci. 4:271-284(1993). 2 PubMed abstract 10037747 3 PubMed abstract 8724342
Domain Name	Pro-MCH
Hormone Name	Neuropeptide-glutamic acid-isoleucine
Mature Hormone Sequence	EIGDEENSAKFPI
Position of mature hormone in Pre-Hormone protein	13 Residues from position (132-144)
Receptor	Q8K3M8 Detail in HMRbase Q3UY93 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 63

HMRbase accession number	11483
Swiss-prot Accession number	P56942 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	Expression is enhanced between postnatal days 10 and 15.
Similarity	Belongs to the MCH family.
Tissue Specificity	Predominantly expressed in hypothalamus. Also found in heart, intestine, spleen and testis (spermatogonia, early spermatocytes and Sertoli cells). In brain only mature MCH and NEI peptides are present. In peripheral tissues a large product, encompassing the NEI and MCH domains of the precursor, is found predominantly
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6. MCH is a cyclic peptide.
Function	MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal
Protein Length	166 Amino acids
Molecular weight	18645
References	1 Breton C., Presse F., Hervieu G., Nahon J.-L.; "Structure and regulation of the mouse melanin-concentrating hormonemRNA and gene."; Mol. Cell. Neurosci. 4:271-284(1993). 2 PubMed abstract 10037747 3 PubMed abstract 8724342
Domain Name	Pro-MCH
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	DFDMLRCMLGRVYRPCWQV
Position of mature hormone in Pre-Hormone protein	19 Residues from position (148-166)
Receptor	Q8K3M8 Detail in HMRbase Q3UY93 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 64

HMRbase accession number	11485
Swiss-prot Accession number	P60041 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Antrin; Somatostatin-28;Somatostatin-14].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12746
References	1 PubMed abstract 1969620 2 PubMed abstract 15489334
Domain Name	Somatostatin
Hormone Name	Somatostatin-28
Mature Hormone Sequence	SANSNPAMAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (89-116)
Receptor	P30873 Detail in HMRbase P30875 Detail in HMRbase P30935 Detail in HMRbase P49660 Detail in HMRbase O08858 Detail in HMRbase
Gene ID	20604
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 65

HMRbase accession number	11486
Swiss-prot Accession number	P60041 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Antrin; Somatostatin-28;Somatostatin-14].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12746
References	1 PubMed abstract 1969620 2 PubMed abstract 15489334
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (103-116)
Receptor	P30873 Detail in HMRbase P30875 Detail in HMRbase P30935 Detail in HMRbase P49660 Detail in HMRbase O08858 Detail in HMRbase
Gene ID	20604
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 66

HMRbase accession number	11497
Swiss-prot Accession number	P70160 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	136 Amino acids
Molecular weight	15141
References	1 PubMed abstract 8806650 2 PubMed abstract 11761712 3 PubMed abstract 15489334
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	Q60755 Detail in HMRbase
Gene ID	12310
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 67

HMRbase accession number	11505
Swiss-prot Accession number	Q812B2 (Sequence in FASTA format)
Description	Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Expressed in the anterior lobe of pituitary
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production
Protein Length	130 Amino acids
Molecular weight	14249
References	1 Feldhaus A., Holloway J.L., O'Hogan S.L., Tackett M., Taft D.,Thayer E.C., Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases. 2 PubMed abstract 16141072 3 PubMed abstract 16210345
Domain Name	Cys_knot
Hormone Name	Glycoprotein hormone beta-5
Mature Hormone Sequence	SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
Position of mature hormone in Pre-Hormone protein	106 Residues from position (25-130)
Receptor	P47750 Detail in HMRbase
Gene ID	217674
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 68

HMRbase accession number	11512
Swiss-prot Accession number	Q9EQX0 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide) (M46protein) [Contains: Ghrelin; Obestatin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	Levels of n-octanoylated and n-decanoylated ghrelin drop by one third and 3-fold, respectively, between postnatal weeks 3 and 4 due to change of diet during weaning.
Similarity	Belongs to the motilin family.
Tissue Specificity	Mainly expressed in the gastrointestinal tract with higher levels in the stomach, medium levels in the duodenum, jejunum, ileum and colon. Low expression in the testis and brain. Not detected in the salivary gland, pancreas, liver and lung
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). The O-n-decanoylated form ghrelin-C10 differs in the length of the carbon backbone of the carboxylic acid bound to Ser- 26. Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	117 Amino acids
Molecular weight	13207
References	1 PubMed abstract 10930375 2 Kojima M.; "Mouse mRNA for preproghrelin."; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 3 Tanaka M., Hayashida Y., Iguchi T., Nakao N., Nakai N., Nakashima K.; Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 16141072 5 PubMed abstract 15746259 6 PubMed abstract 11306336
Domain Name	Motilin_assoc Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKAQQRKESKKPPAKLQPR
Position of mature hormone in Pre-Hormone protein	28 Residues from position (24-51)
Receptor	Q99P50 Detail in HMRbase
Gene ID	58991
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 69

HMRbase accession number	11513
Swiss-prot Accession number	Q9EQX0 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide) (M46protein) [Contains: Ghrelin; Obestatin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	Levels of n-octanoylated and n-decanoylated ghrelin drop by one third and 3-fold, respectively, between postnatal weeks 3 and 4 due to change of diet during weaning.
Similarity	Belongs to the motilin family.
Tissue Specificity	Mainly expressed in the gastrointestinal tract with higher levels in the stomach, medium levels in the duodenum, jejunum, ileum and colon. Low expression in the testis and brain. Not detected in the salivary gland, pancreas, liver and lung
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). The O-n-decanoylated form ghrelin-C10 differs in the length of the carbon backbone of the carboxylic acid bound to Ser- 26. Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	117 Amino acids
Molecular weight	13207
References	1 PubMed abstract 10930375 2 Kojima M.; "Mouse mRNA for preproghrelin."; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 3 Tanaka M., Hayashida Y., Iguchi T., Nakao N., Nakai N., Nakashima K.; Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 16141072 5 PubMed abstract 15746259 6 PubMed abstract 11306336
Domain Name	Motilin_assoc Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPFDVGIKLSGAQYQQHGRAL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (76-98)
Receptor	Q99P50 Detail in HMRbase
Gene ID	58991
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 70

HMRbase accession number	11533
Swiss-prot Accession number	P41160 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18709
References	1 PubMed abstract 7984236
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	P48356 Detail in HMRbase Q9CQ74 Detail in HMRbase O89013 Detail in HMRbase A2AV64 Detail in HMRbase A2AV69 Detail in HMRbase Q3UNU8 Detail in HMRbase Q3US58 Detail in HMRbase Q545G9 Detail in HMRbase
Gene ID	16846
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 71

HMRbase accession number	11566
Swiss-prot Accession number	Q544U0 (Sequence in FASTA format)
Description	Leptin; Putative uncharacterized protein; Leptin, isoform CRA_a
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	167 Amino acids
Molecular weight	18709
References	1 PubMed abstract 10349636 2 PubMed abstract 16141072 3 PubMed abstract 16141073 4 PubMed abstract 12466851 5 PubMed abstract 11217851 6 PubMed abstract 11042159 7 PubMed abstract 11076861 8 PubMed abstract 12040188 9 PubMed abstract 15489334
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	P48356 Detail in HMRbase Q9CQ74 Detail in HMRbase O89013 Detail in HMRbase A2AV64 Detail in HMRbase A2AV69 Detail in HMRbase Q3UNU8 Detail in HMRbase Q3US58 Detail in HMRbase Q545G9 Detail in HMRbase
Gene ID	16846
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 72

HMRbase accession number	11571
Swiss-prot Accession number	P06281 (Sequence in FASTA format)
Description	Renin-1; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Alternative Name: Kidney renin;Precursor
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	Kidney
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Protein Length	402 Amino acids
Molecular weight	44343
References	1 PubMed abstract 6370686 2 PubMed abstract 2685761 3 PubMed abstract 2691339 4 PubMed abstract 16141072 5 PubMed abstract 15489334 6 PubMed abstract 6089205 7 PubMed abstract 6392850 8 PubMed abstract 9030738 9 PubMed abstract 6327270
Domain Name	A1_Propeptide Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9CYN9 Detail in HMRbase
Gene ID	19701
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 73

HMRbase accession number	11572
Swiss-prot Accession number	P00796 (Sequence in FASTA format)
Description	Renin-2; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Alternative Name: Submandibular gland renin;Contains: Renin-2 heavy chain;Contains: Renin-2 light chain;Precursor
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	Submandibular gland
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, related to pepsin, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Its function in the salivary gland is not understood.
Protein Length	401 Amino acids
Molecular weight	44283
References	1 PubMed abstract 6812055 2 PubMed abstract 6283373 3 PubMed abstract 15489334 4 PubMed abstract 6089205 5 PubMed abstract 2691339 6 PubMed abstract 6392850 7 PubMed abstract 6357783 8 PubMed abstract 1608447
Domain Name	A1_Propeptide Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9CYN9 Detail in HMRbase
Gene ID	19702
PDB ID	1SMR
Drugpedia	wiki
Comments

Search Result - 74

HMRbase accession number	11582
Swiss-prot Accession number	Q9JM79 (Sequence in FASTA format)
Description	Aspartic proteinase family member similar to renin
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	419 Amino acids
Molecular weight	45500
References	1 PubMed abstract 9507200
Domain Name	Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9CYN9 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments